OuterStats is here to display any thing is needed for www.srikrishnaswamykalyanamandapam.com. We seek and locate Srikrishnaswamykalyanamandapam.com information for inquirer. We will show you Srikrishnaswamykalyanamandapam value, date of creation, location, hosted server, local language and estimated data - The estimated data is a special algorithm built by us to demonstrate www.srikrishnaswamykalyanamandapam.com worth.

HOME - srikrishnaswamy kalyana mandapam

Srikrishnaswamykalyanamandapam.com was created on the 2003-06-03, domain is hosted in ip:, and owner of this ips: QTS-209-11-128-0-18 . Our algorithm estimates Srikrishnaswamykalyanamandapam.com worth to be about $373 and estimates that it gets about 93 visits per day. Srikrishnaswamykalyanamandapam.com is located in United States. Srikrishnaswamykalyanamandapam.com using Apache server and powered by unknown.

Created: 03/06/2003

Expires: unavailable

Hosted in: United States

Host IP:

ICANN Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com

Domain Archive: srikrishnaswamykalyanamandapam.com in the past

Alexa Rank: #10817085

Google Page Rank: 0

Server DNS A:

Server DNS NS: ns1.webindia.com ns2.webindia.com

Server Name: unavailable

Server Type: Apache

Server Side Language: unavailable

srikrishnaswamykalyanamandapam.com - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Mandapam 11 7.33
Kalyana 10 6.67
Sri 5 3.33
Krishnaswamy 5 3.33
Services 4 2.67
Hall 3 2
Road 3 2
Enquiry 3 2
Chennai 2 1.33
Srikrishnaswamy 2 1.33
Attached 2 1.33
Nagar 2 1.33
Phone 2 1.33
Boag 2 1.33
Designed 2 1.33
Done 2 1.33
Sent 2 1.33
Successfully 2 1.33
Kanthimathi 2 1.33
Lift 2 1.33
Times 2 1.33
Header Key Header Value
Date Wed, 24 Jan 2018 05:45:07 GMT
Server Apache
Transfer-Encoding chunked
Content-Type text/html

We believe that every website pwner is able to earn money from his website.

Our estimations point that your Website Worth is $372.63, Your Daily Visitors could be in the area of 93 per day and your estimated Daily Revenues could be around $0.28.

Server Country Code: US

Server Country Name: United States

Server City Name: Overland Park

Server Region Name: KS

Server Zip Code: 66213

Server Latitude: 38.899799346924

Server Longitude: -94.705200195312

Server location

srikbishnaswamykalyanamandapam.com, srikgishnaswamykalyanamandapam.com, srikrashnaswamykalyanamandapam.com, srikrishnaswamykalyanamandapam.com, srikrishnassamykalyanamandapam.com, srikrishnaswrmykalyanamandapam.com, srikrishnaswarykalyanamandapam.com, srikrishnaswamycalyanamandapam.com, srikrishnaswamysalyanamandapam.com, srikrishnaswamykclyanamandapam.com, srikrishnaswamykalpanamandapam.com, srikrishnaswamykalynnamandapam.com, srikrishnaswamykalyaamandapam.com, srikrishnaswamykalyanarandapam.com, srikrishnaswamykalyanazandapam.com, srikrishnaswamykalyanamhndapam.com, srikrishnaswamykalyanamapdapam.com, srikrishnaswamykalyanamanfapam.com, srikrishnaswamykalyanamanlapam.com, srikrishnaswamykalyanamandabam.com, srikrishnaswamykalyanamandapam.coj, srikrishnaswamykalyanamandapam.cox, srkirishnaswamykalyanamandapam.com, vsrikrishnaswamykalyanamandapam.com, ysrikrishnaswamykalyanamandapam.com, syrikrishnaswamykalyanamandapam.com, sraikrishnaswamykalyanamandapam.com, srdikrishnaswamykalyanamandapam.com, srlikrishnaswamykalyanamandapam.com, srxikrishnaswamykalyanamandapam.com, sryikrishnaswamykalyanamandapam.com, srilkrishnaswamykalyanamandapam.com, srikribshnaswamykalyanamandapam.com, srikrivshnaswamykalyanamandapam.com, srikrishhnaswamykalyanamandapam.com, srikrismhnaswamykalyanamandapam.com, srikrishnuaswamykalyanamandapam.com, srikrishnaswaumykalyanamandapam.com, srikrishnaswamlykalyanamandapam.com, srikrishnaswamyckalyanamandapam.com, srikrishnaswamykalyqanamandapam.com, srikrishnaswamykalyapnamandapam.com, srikrishnaswamykalyantamandapam.com, srikrishnaswamykalyanamdandapam.com, srikrishnaswamykalyanamaendapam.com, srikrishnaswamykalyanamandapamz.com, srikrishnaswamykalyanamandapam.ecom, srikrishnaswamykalyanamandapam.codm, srikrishnaswamykalyanamandapam.coym, srikrishnaswamykalyanamandapam.comh

Registry Domain ID: 98693860_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2017-06-02T13:36:16Z
Creation Date: 2003-06-03T13:10:22Z
Registry Expiry Date: 2018-06-03T13:10:22Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: ******
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: ok https://icann.org/epp#ok
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-01-24T05:45:02Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and